PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g021302m
Common NameCISIN_1g021302mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family ZF-HD
Protein Properties Length: 315aa    MW: 34854.6 Da    PI: 9.6229
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g021302mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer105.82.6e-33140196360
        ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                        ++rY+eClkNhAa++G+h++DGCgEfmps ge+gt+++lkCaAC+CHRnFHR+e + e
  orange1.1g021302m 140 SIRYRECLKNHAANMGSHVIDGCGEFMPS-GEDGTPEGLKCAACDCHRNFHRKEIDGE 196
                        689*************************9.999********************98765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047702.8E-30141193IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257741.0E-20142195IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.7E-30142193IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.083143192IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MELQGKEKEI GMTSSMRYNR DSSSTVSTPI NSIAGEMIRD QGTVHGEAIF NLPQTLDQHH  60
HPLYRHHQSN SQQQQQPQTQ QNLQNKPSAG SSNPEAQHPD PVPVSVANTT TTSTKEANRS  120
NQRSPAQAPT TSTAIITAPS IRYRECLKNH AANMGSHVID GCGEFMPSGE DGTPEGLKCA  180
ACDCHRNFHR KEIDGESQSQ SQYAAHSLYT YNYPSRNNST QRNHHHQQQQ QPPPPFHHLQ  240
QHHRISYTSP QTASIAPMMM TFGGGAGPGA VAGALMSRQA RISTCFILVQ VDRHRCRPRK  300
RGLGQSFPRN RKTR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006425664.11e-157hypothetical protein CICLE_v10025926mg
RefseqXP_006466804.11e-157PREDICTED: zinc-finger homeodomain protein 6-like
TrEMBLA0A067GVU90.0A0A067GVU9_CITSI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65152543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75240.12e-27homeobox protein 33